ABCC1 monoclonal antibody, clone IU5C1
  • ABCC1 monoclonal antibody, clone IU5C1

ABCC1 monoclonal antibody, clone IU5C1

Ref: AB-MAB2374
ABCC1 monoclonal antibody, clone IU5C1

Información del producto

Mouse monoclonal antibody raised against synthetic peptide of ABCC1.
Información adicional
Size 100 uL
Gene Name ABCC1
Gene Alias ABC29|ABCC|DKFZp686N04233|DKFZp781G125|GS-X|MRP|MRP1
Gene Description ATP-binding cassette, sub-family C (CFTR/MRP), member 1
Storage Conditions Store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq SMALRGFCSADGSDPLWDWNVTWNTSNPDFTKCF
Form Liquid
Recomended Dilution Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to amino acids 1-33 of human ABCC1.
Storage Buffer In buffer containing 0.09% sodium azide
Gene ID 4363
Clone Number IU5C1
Iso type IgG1

Enviar uma mensagem


ABCC1 monoclonal antibody, clone IU5C1

ABCC1 monoclonal antibody, clone IU5C1