Atxn1 monoclonal antibody, clone S76-8 (APC)
  • Atxn1 monoclonal antibody, clone S76-8 (APC)

Atxn1 monoclonal antibody, clone S76-8 (APC)

Ref: AB-MAB17079
Atxn1 monoclonal antibody, clone S76-8 (APC)

Información del producto

Mouse monoclonal antibody raised against synthetic peptide of mouse Atxn1.
Información adicional
Size 100 ug
Gene Name Atxn1
Gene Alias Ataxin-1|Atx1|C85907|Sca1
Gene Description ataxin 1
Storage Conditions Store at -20C.
Application Key WB-Tr,IHC-P,ICC,IF,IP
Immunogen Prot. Seq ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP
Form Liquid
Recomended Dilution Immunocytochemistry (1:100)
Immunofluorescence (1:100)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoprecipitation
Western Blot (1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Immunogen A synthetic peptide corresponding to amino acids 164-197 of mouse Atxn1.
Storage Buffer In PBS, pH 7.4 (50% glycerol, 0.09% sodium azide).
Gene ID 20238
Clone Number S76-8
Iso type IgG2b
Conjugation APC

Enviar uma mensagem


Atxn1 monoclonal antibody, clone S76-8 (APC)

Atxn1 monoclonal antibody, clone S76-8 (APC)