ARID1A monoclonal antibody, clone CL3595
  • ARID1A monoclonal antibody, clone CL3595

ARID1A monoclonal antibody, clone CL3595

Ref: AB-MAB15809
ARID1A monoclonal antibody, clone CL3595

Información del producto

Mouse monoclonal antibody raised against partial recombinant human ARID1A.
Información adicional
Size 100 uL
Gene Name ARID1A
Gene Alias B120|BAF250|BAF250a|BM029|C1orf4|P270|SMARCF1
Gene Description AT rich interactive domain 1A (SWI-like)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq PGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPDSGMYSPSRYPPQQQQQQQQRHDSYGNQFSTQGTPSGSPFPSQQTTMYQQQQQNYK
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human ARID1A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 8289
Clone Number CL3595
Iso type IgG1

Enviar uma mensagem


ARID1A monoclonal antibody, clone CL3595

ARID1A monoclonal antibody, clone CL3595