ZYX monoclonal antibody, clone CL2502
  • ZYX monoclonal antibody, clone CL2502

ZYX monoclonal antibody, clone CL2502

Ref: AB-MAB15751
ZYX monoclonal antibody, clone CL2502

Información del producto

Mouse monoclonal antibody raised against partial recombinant human ZYX.
Información adicional
Size 100 uL
Gene Name ZYX
Gene Alias ESP-2|HED-2
Gene Description zyxin
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq PAPKFSPVTPKFTPVASKFSPGAPGGSGSQPNQKLGHPEALSAGTGSPQPPSFTYAQQREKPRVQEKQHPVPPPAQNQNQVRSPGAPGPLTLKEVEELEQLTQQLMQDMEHPQRQNVAVNE
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:5000-1:10000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human ZYX.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 7791
Clone Number CL2502
Iso type IgG2b

Enviar uma mensagem


ZYX monoclonal antibody, clone CL2502

ZYX monoclonal antibody, clone CL2502