USP30 monoclonal antibody, clone CL4438
  • USP30 monoclonal antibody, clone CL4438

USP30 monoclonal antibody, clone CL4438

Ref: AB-MAB15709
USP30 monoclonal antibody, clone CL4438

Información del producto

Mouse monoclonal antibody raised against partial recombinant human USP30.
Información adicional
Size 100 uL
Gene Name USP30
Gene Alias FLJ40511|MGC10702
Gene Description ubiquitin specific peptidase 30
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq IEAKGTLNGEKVEHQRTTFVKQLKLGKLPQCLCIHLQRLSWSSHGTPLKRHEHVQFNEFLMMDIYKYHLLGHKPSQHNPKLNKNPGPTLELQDGPGAPTPVLNQPGAPKTQIFMNGACSPSLLPTLSAPMPFPLPVVPDYSSST
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human USP30.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 84749
Clone Number CL4438
Iso type IgG2a

Enviar uma mensagem


USP30 monoclonal antibody, clone CL4438

USP30 monoclonal antibody, clone CL4438