ARG1 monoclonal antibody, clone CL0186
  • ARG1 monoclonal antibody, clone CL0186

ARG1 monoclonal antibody, clone CL0186

Ref: AB-MAB15555
ARG1 monoclonal antibody, clone CL0186

Información del producto

Mouse monoclonal antibody raised against partial recombinant human ARG1.
Información adicional
Size 100 uL
Gene Name ARG1
Gene Alias -
Gene Description arginase, liver
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,IHC-P
Immunogen Prot. Seq TIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDA
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:2500-1:5000)
Western Blot (1:1000-1:2500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human ARG1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 383
Clone Number CL0186
Iso type IgG1

Enviar uma mensagem


ARG1 monoclonal antibody, clone CL0186

ARG1 monoclonal antibody, clone CL0186