AB-MAB1180-M03
New product
This product is no longer in stock
Availability date:
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Size | 100 ug |
Gene Name | TNFRSF10A |
Gene Alias | APO2|CD261|DR4|MGC9365|TRAILR-1|TRAILR1 |
Gene Description | tumor necrosis factor receptor superfamily, member 10a |
Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
Application Key | ELISA |
Immunogen Prot. Seq | VVPSSAATIKLHDQSIGTQQWEHSPLGELCPPGSHRSEHPGACNRCTEGVGYTNASNNLFACLPCTACKSDEEERSPCTTTRNTACQCKPGTFRNDNSAEMCRKCSRGCPRGMVKVKDCTPWSDIECVHKESGNGHN |
Antigen species Target species | Human |
Quality control testing | Antibody Reactive Against Recombinant Protein. |
Immunogen | TNFRSF10A (AAH12866.1, 103 a.a. ~ 239 a.a) partial recombinant protein. |
Storage Buffer | In 1x PBS, pH 7.4 |
Gene ID | 8797 |
Clone Number | 7F8 |
Iso type | IgG1 Kappa |