CARD17 monoclonal antibody (M01A), clone 1G6
  • CARD17 monoclonal antibody (M01A), clone 1G6

CARD17 monoclonal antibody (M01A), clone 1G6

Ref: AB-H00440068-M01A
CARD17 monoclonal antibody (M01A), clone 1G6

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant CARD17.
Información adicional
Size 200 uL
Gene Name CARD17
Gene Alias INCA
Gene Description caspase recruitment domain family, member 17
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq MADKVLKEKRKQFIRSVGEGTINGLLGELLETRVLSQEEIEIVKCENATVMDKARALLDSVIRKGAPACQICITYICEEDSHLAGTLGLSAGPTSGNHLTTQDSQIVLPS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CARD17 (NP_001007233.1, 1 a.a. ~ 110 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 440068
Clone Number 1G6
Iso type IgG2a Kappa

Enviar uma mensagem


CARD17 monoclonal antibody (M01A), clone 1G6

CARD17 monoclonal antibody (M01A), clone 1G6