BRCC2 polyclonal antibody (A01)
  • BRCC2 polyclonal antibody (A01)

BRCC2 polyclonal antibody (A01)

Ref: AB-H00414899-A01
BRCC2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant BRCC2.
Información adicional
Size 50 uL
Gene Name BLID
Gene Alias BRCC2|BRCC@|MGC163233|MGC163235
Gene Description BH3-like motif containing, cell death inducer
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq VTLLPIEGQEVHFFEILESECVLYTGWIERASGSSIYPEAKARLPLEALLGSNKEPMLPKETVLSLKRYNLGSSAMKRNVPGHVLQRPSYLTRIQVTLLCNSSAEAL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen BRCC2 (NP_001001786, 2 a.a. ~ 108 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 414899

Enviar uma mensagem


BRCC2 polyclonal antibody (A01)

BRCC2 polyclonal antibody (A01)