C9orf103 monoclonal antibody (M10), clone 3B7
  • C9orf103 monoclonal antibody (M10), clone 3B7

C9orf103 monoclonal antibody (M10), clone 3B7

Ref: AB-H00414328-M10
C9orf103 monoclonal antibody (M10), clone 3B7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant C9orf103.
Información adicional
Size 100 ug
Gene Name C9orf103
Gene Alias bA522I20.2
Gene Description chromosome 9 open reading frame 103
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq KKTYRDILTQGKDGVALKCEESGKEAKQAEMQLLVVHLSGSFEVISGRLLKREGHFMPPELLQSQFETLEPPAAPENFIQISVDKNVSEIIATIMETLKMK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen C9orf103 (NP_001001551, 41 a.a. ~ 141 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 414328
Clone Number 3B7
Iso type IgG2a Kappa

Enviar uma mensagem


C9orf103 monoclonal antibody (M10), clone 3B7

C9orf103 monoclonal antibody (M10), clone 3B7