C16orf85 purified MaxPab mouse polyclonal antibody (B01P)
  • C16orf85 purified MaxPab mouse polyclonal antibody (B01P)

C16orf85 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00400555-B01P
C16orf85 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human C16orf85 protein.
Información adicional
Size 50 ug
Gene Name C16orf85
Gene Alias FLJ45530
Gene Description chromosome 16 open reading frame 85
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MIVSRYGLVGCDAGQVRPKVELSLPAFLALPKKEFKDKPEVEENNLIEEAVWQTSLKIPLPQAQVRERGGGSAGISAAHPSQLCTAGVRPSSALRASRPGWSLQTAALQEPTGADSFLPRSHKTAVDLHSARIPLYIHTKCLLMESV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen C16orf85 (AAI53154.1, 1 a.a. ~ 147 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 400555

Enviar uma mensagem


C16orf85 purified MaxPab mouse polyclonal antibody (B01P)

C16orf85 purified MaxPab mouse polyclonal antibody (B01P)