C11orf88 DNAxPab
  • C11orf88 DNAxPab

C11orf88 DNAxPab

Ref: AB-H00399949-W01P
C11orf88 DNAxPab

Información del producto

Rabbit polyclonal antibody raised against a full-length human C11orf88 DNA using DNAx™ Immune technology.
Información adicional
Size 100 ug
Gene Name C11orf88
Gene Alias FLJ46266
Gene Description chromosome 11 open reading frame 88
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF-Tr,Flow Cyt-Tr
Immunogen Prot. Seq METGPSEEPSGRKESQEMCPPGLLVFAGSSEQDANLAKQFWISASMYPPSESQLVLRRDSSQRLPVARPRRSRGSENSHSSQSFHLASNKNRDIFAEALKIQESEEKVKYLQKTRSHSVTQNEVQWHDHGSLQPQLSRIQAKTREEILQLLRKQREERISKELISLPYKPKAKEHKAE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen C11orf88 (NP_997313.1, 1 a.a. ~ 178 a.a) full-length human DNA
Storage Buffer In 1x PBS, pH 7.4
Gene ID 399949

Enviar uma mensagem


C11orf88 DNAxPab

C11orf88 DNAxPab