VGLL3 MaxPab rabbit polyclonal antibody (D01)
  • VGLL3 MaxPab rabbit polyclonal antibody (D01)

VGLL3 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00389136-D01
VGLL3 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human VGLL3 protein.
Información adicional
Size 100 uL
Gene Name VGLL3
Gene Alias DKFZp686O1845|FLJ38507|VGL-3|VGL3
Gene Description vestigial like 3 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IP
Immunogen Prot. Seq MSCAEVMYHPQPYGASQYLPNPMAATTCPTAYYQPAPQPGQQKKLAVFSKMQDSLEVTLPSKQEEEDEEEEEEEKDQPAEMEYLNSRCVLFTYFQGDIGSVVDEHFSRALGQAITLHPESAISKSKMGLTPLWRDSSALSSQRNSFPTSFWTSSYQPPPAPCLGGVHPDFQVTGPPGTFSAADPSPWPGHNLHQTGPAPPPAVSESWPYPLTSQVSPSYSHMHDVYMRHHHPHAHMHHRHRHHHHHHHPPAGSAL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen VGLL3 (AAH94780.1, 1 a.a. ~ 320 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 389136

Enviar uma mensagem


VGLL3 MaxPab rabbit polyclonal antibody (D01)

VGLL3 MaxPab rabbit polyclonal antibody (D01)