TRIM50C purified MaxPab mouse polyclonal antibody (B01P)
  • TRIM50C purified MaxPab mouse polyclonal antibody (B01P)

TRIM50C purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00378108-B01P
TRIM50C purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TRIM50C protein.
Información adicional
Size 50 ug
Gene Name TRIM74
Gene Alias MGC45440|TRIM50C
Gene Description tripartite motif-containing 74
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAWQVSLLELEDRLQCPICLEVFKESLMLQCGHSYCKGCLVSLSYHLDTKVRCPMCWQVVDGSSSLPNVSLAWVIEALRLPGDPEPKVCVHHRNPLSLFCEKDQELICGLCGLLGSHQHHPVTPVSTICSRMKEELAALFSELKQEQKKVDELIAKLVNNRTRIVNESDVFSWVIRREFQELRHPVDEEKARCLEGIGGHTRGLVASLDMQLEQAQGTRERLAQAECVLEQFGNEDHHEFIWFHSMASR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TRIM50C (AAH33871, 1 a.a. ~ 249 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 378108

Enviar uma mensagem


TRIM50C purified MaxPab mouse polyclonal antibody (B01P)

TRIM50C purified MaxPab mouse polyclonal antibody (B01P)