TMEM179B monoclonal antibody (M01), clone 3G8
  • TMEM179B monoclonal antibody (M01), clone 3G8

TMEM179B monoclonal antibody (M01), clone 3G8

Ref: AB-H00374395-M01
TMEM179B monoclonal antibody (M01), clone 3G8

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant TMEM179B.
Información adicional
Size 100 ug
Gene Name TMEM179B
Gene Alias -
Gene Description transmembrane protein 179B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MALSWLQRVELALFAAAFLCGAVAAAAMTRTQGSFSGRCPLYGVATLNGSSLALSRPSAPSLCYFVAGASGLLALYCLLLLLFWIYSSCIEDSHRGAIGLRIALAISAIAVFLVLVSACILRFGTRSLCNSIISLNTTISCSEAQKIPWTPPGTALQFYSNLHNAETSSWVNLVLWCVVLVLQVVQWKSEATPYRPLERGDPEWSSETDALVGSRLSHS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TMEM179B (NP_955369.1, 1 a.a. ~ 219 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 374395
Clone Number 3G8
Iso type IgG2a Kappa

Enviar uma mensagem


TMEM179B monoclonal antibody (M01), clone 3G8

TMEM179B monoclonal antibody (M01), clone 3G8