ANKRD37 monoclonal antibody (M02), clone 6E8
  • ANKRD37 monoclonal antibody (M02), clone 6E8

ANKRD37 monoclonal antibody (M02), clone 6E8

Ref: AB-H00353322-M02
ANKRD37 monoclonal antibody (M02), clone 6E8

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant ANKRD37.
Información adicional
Size 100 ug
Gene Name ANKRD37
Gene Alias Lrp2bp|MGC111507
Gene Description ankyrin repeat domain 37
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq MLLLDCNPEVDGLKHLLETGASVNAPPDPCKQSPVHLAAGSGLACFLLWQLQTGADLNQQDVLGEAPLHKAAKVGSLECLSLLVASDAQIDLCNKNGQTAEDLAWSCGFPDCAKFLTTIKCMQTIKASEHPDRNDCVAVLRQKRSLGSVENTSGKRKC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ANKRD37 (NP_859077.1, 1 a.a. ~ 158 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 353322
Clone Number 6E8
Iso type IgG2a Kappa

Enviar uma mensagem


ANKRD37 monoclonal antibody (M02), clone 6E8

ANKRD37 monoclonal antibody (M02), clone 6E8