ARSH purified MaxPab mouse polyclonal antibody (B01P)
  • ARSH purified MaxPab mouse polyclonal antibody (B01P)

ARSH purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00347527-B01P
ARSH purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ARSH protein.
Información adicional
Size 50 ug
Gene Name ARSH
Gene Alias sulfatase
Gene Description arylsulfatase family, member H
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MTRNARPNIVLLMADDLGVGDLCCYGNNSVSTPNIDRLASEGVRLTQHLAAASMCTPSRAAFLTGRYPIRSGMVSAYNLNRAFTWLGGSGGLPTNETTFAKLLQHRGYRTGLIGKWHLGLSCASRNDHCYHPLNHGFHYFYGVPFGLLSDCQASKTPELHRWLRIKLWISTVALALVPFLLLIPKFARWFSVPWKVIFVFALLAFLFFTSWYSSYGFTRRWNCILMRNHEIIQQPMKEEKVASLMLKEALAFIER
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ARSH (AAI53086.1, 1 a.a. ~ 562 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 347527

Enviar uma mensagem


ARSH purified MaxPab mouse polyclonal antibody (B01P)

ARSH purified MaxPab mouse polyclonal antibody (B01P)