ZNF81 monoclonal antibody (M07), clone 3G3
  • ZNF81 monoclonal antibody (M07), clone 3G3

ZNF81 monoclonal antibody (M07), clone 3G3

Ref: AB-H00347344-M07
ZNF81 monoclonal antibody (M07), clone 3G3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ZNF81.
Información adicional
Size 100 ug
Gene Name ZNF81
Gene Alias FLJ44367|HFZ20|MRX45
Gene Description zinc finger protein 81
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq MPANEDAPQPGEHGSACEVSVSFEDVTVDFSREEWQQLDSTQRRLYQDVMLENYSHLLSVGFEVPKPEVIFKLEQGEGPWTLEGEAPHQSCSDGKFGIKPSQRRISGKSTFHSEMEGEDTLC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ZNF81 (NP_009068.1, 1 a.a. ~ 122 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 347344
Clone Number 3G3
Iso type IgG2b Kappa

Enviar uma mensagem


ZNF81 monoclonal antibody (M07), clone 3G3

ZNF81 monoclonal antibody (M07), clone 3G3