ZNF81 monoclonal antibody (M07), clone 3G3 View larger

Mouse monoclonal antibody raised against a partial recombinant ZNF81.

AB-H00347344-M07

New product

ZNF81 monoclonal antibody (M07), clone 3G3

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name ZNF81
Gene Alias FLJ44367|HFZ20|MRX45
Gene Description zinc finger protein 81
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq MPANEDAPQPGEHGSACEVSVSFEDVTVDFSREEWQQLDSTQRRLYQDVMLENYSHLLSVGFEVPKPEVIFKLEQGEGPWTLEGEAPHQSCSDGKFGIKPSQRRISGKSTFHSEMEGEDTLC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ZNF81 (NP_009068.1, 1 a.a. ~ 122 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 347344
Clone Number 3G3
Iso type IgG2b Kappa

More info

Mouse monoclonal antibody raised against a partial recombinant ZNF81.

Enviar uma mensagem

Mouse monoclonal antibody raised against a partial recombinant ZNF81.

Mouse monoclonal antibody raised against a partial recombinant ZNF81.