VSIG1 MaxPab mouse polyclonal antibody (B01P)
  • VSIG1 MaxPab mouse polyclonal antibody (B01P)

VSIG1 MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00340547-B01P
VSIG1 MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human VSIG1 protein.
Información adicional
Size 50 ug
Gene Name VSIG1
Gene Alias 1700062D20Rik|GPA34|MGC44287|dJ889N15.1
Gene Description V-set and immunoglobulin domain containing 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MVFAFWKVFLILSCLAGQVSVVQVTIPDGFVNVTVGSNVTLICIYTTTVASREQLSIQWSFFHKKEMEPISIYFSQGGQAVAIGQFKDRITGSNDPGNASITISHMQPADSGIYICDVNNPPDFLGQNQGILNVSVLVKPSKPLCSVQGRPETGHTISLSCLSALGTPSPVYYWHKLEGRDIVPVKENFNPTTGILVIGNLTNFEQGYYQCTAINRLGNSSCEIDLTSSHPEVGIIVGALIGSLVGAAIIISVVC
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen VSIG1 (NP_872413, 1 a.a. ~ 387 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 340547

Enviar uma mensagem


VSIG1 MaxPab mouse polyclonal antibody (B01P)

VSIG1 MaxPab mouse polyclonal antibody (B01P)