ZBTB8OS monoclonal antibody (M01), clone 1G4
  • ZBTB8OS monoclonal antibody (M01), clone 1G4

ZBTB8OS monoclonal antibody (M01), clone 1G4

Ref: AB-H00339487-M01
ZBTB8OS monoclonal antibody (M01), clone 1G4

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant ZBTB8OS.
Información adicional
Size 100 ug
Gene Name ZBTB8OS
Gene Alias ARCH|ARCH2|MGC62007
Gene Description zinc finger and BTB domain containing 8 opposite strand
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MAQEEEDVRDYNLTEEQKAIKAKYPPVNRKYEYLDHTADVQLHAWGDTLEEAFEQCAMAMFGYMTDTGTVEPLQTVEVETQGDDLQSLLFHFLDEWLYKFSADEFFIPRVGRRIFIVQAPSGNRSQSNNIFSNAGL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ZBTB8OS (AAH58843.1, 1 a.a. ~ 136 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 339487
Clone Number 1G4
Iso type IgG2a Kappa

Enviar uma mensagem


ZBTB8OS monoclonal antibody (M01), clone 1G4

ZBTB8OS monoclonal antibody (M01), clone 1G4