TPRX1 monoclonal antibody (M02), clone 2B4
  • TPRX1 monoclonal antibody (M02), clone 2B4

TPRX1 monoclonal antibody (M02), clone 2B4

Ref: AB-H00284355-M02
TPRX1 monoclonal antibody (M02), clone 2B4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TPRX1.
Información adicional
Size 100 ug
Gene Name TPRX1
Gene Alias FLJ40321|TPRX
Gene Description tetra-peptide repeat homeobox 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IHC-P,ELISA
Immunogen Prot. Seq GSGSVPAPIPGPGSLPAPAPLWPQSPDASDFLPDTQLFPHFTELLLPLDPLEGSSVSTMTSQYQEGDDSMGKKHSGSQPQEEGGSVNENHSGPRLLLDL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TPRX1 (NP_940881, 313 a.a. ~ 411 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 284355
Clone Number 2B4
Iso type IgG2a Kappa

Enviar uma mensagem


TPRX1 monoclonal antibody (M02), clone 2B4

TPRX1 monoclonal antibody (M02), clone 2B4