B4GALNT3 purified MaxPab mouse polyclonal antibody (B01P)
  • B4GALNT3 purified MaxPab mouse polyclonal antibody (B01P)

B4GALNT3 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00283358-B01P
B4GALNT3 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human B4GALNT3 protein.
Información adicional
Size 50 ug
Gene Name B4GALNT3
Gene Alias B4GalNac-T3|FLJ16224|FLJ40362
Gene Description beta-1,4-N-acetyl-galactosaminyl transferase 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGSPRAARPPLLLRPVKLLRRRFRLLLALAVVSVGLWTLYLELVASAQVGGNPLNRRYGSWRELAKALASRNIPAVDPHLQFYHPQRLSLEDHDIDQGVSSNSSYLKWNKPVPWLSEFRGRANLHVFEDWCGSSIQQLRRNLHFPLYPHIRTTLRKLAVSPKWTNYGLRIFGYLHPFTDGKIQFAIAADDNAEFWLSLDDQVSGLQLLASVGKTGKEWTAPGEFGKFRSQISKPVSLSASHRYYFEVLHKQNEEG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen B4GALNT3 (AAI56654.1, 1 a.a. ~ 998 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 283358

Enviar uma mensagem


B4GALNT3 purified MaxPab mouse polyclonal antibody (B01P)

B4GALNT3 purified MaxPab mouse polyclonal antibody (B01P)