TTC9C monoclonal antibody (M06), clone 7H10
  • TTC9C monoclonal antibody (M06), clone 7H10

TTC9C monoclonal antibody (M06), clone 7H10

Ref: AB-H00283237-M06
TTC9C monoclonal antibody (M06), clone 7H10

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant TTC9C.
Información adicional
Size 100 ug
Gene Name TTC9C
Gene Alias MGC29649
Gene Description tetratricopeptide repeat domain 9C
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MEKRLQEAQLYKEEGNQRYREGKYRDAVSRYHRALLQLRGLDPSLPSPLPNLGPQGPALTPEQENILHTTQTDCYNNLAACLLQMEPVNYERVREYSQKVLERQPDNAKALYRAGVAFFHLQDYDQARHYLLAAVNRQPKDANVRRYLQLTQSELSSYHRKEKQLYLGMFG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TTC9C (NP_776171.1, 1 a.a. ~ 171 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 283237
Clone Number 7H10
Iso type IgG2a Kappa

Enviar uma mensagem


TTC9C monoclonal antibody (M06), clone 7H10

TTC9C monoclonal antibody (M06), clone 7H10