C10orf48 polyclonal antibody (A01)
  • C10orf48 polyclonal antibody (A01)

C10orf48 polyclonal antibody (A01)

Ref: AB-H00283078-A01
C10orf48 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant C10orf48.
Información adicional
Size 50 uL
Gene Name MKX
Gene Alias C10orf48|IFRX|IRXL1|MGC39616
Gene Description mohawk homeobox
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq MNTIVFNKLSSAVLFEDGGASERERGGRPYSGVLDSPHARPEVGIPDGPPLKDNLGLRHRRTGARQNGGKVRHKRQALQDMARPLKQWLYKHRDN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen C10orf48 (NP_775847, 1 a.a. ~ 95 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 283078

Enviar uma mensagem


C10orf48 polyclonal antibody (A01)

C10orf48 polyclonal antibody (A01)