ZNF683 purified MaxPab mouse polyclonal antibody (B01P)
  • ZNF683 purified MaxPab mouse polyclonal antibody (B01P)

ZNF683 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00257101-B01P
ZNF683 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ZNF683 protein.
Información adicional
Size 50 ug
Gene Name ZNF683
Gene Alias MGC33414
Gene Description zinc finger protein 683
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MALGGTGGSLSPSLDFQLFRGDQVFSACRPLPDMVDAHGPSCASWLCPLPLAPGRSALLACLQDLDLNLCTPQPAPLGTDLQGLQEDALSMKHEPPGLQASSTDDKKFTVKYPQNKDKLGKQPERAGEGAPCPAFSSHNSSSPPPLQNRKSPSPLAFCPCPPVNSISKELPFLLHAFYPGYPLLLPPPNLFTYGALPSDQCPHLLMLPQDPSYPTMAMPSLLMMVNELGHPSARWETLLPYPGAFQASGQALPSQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ZNF683 (NP_775845.1, 1 a.a. ~ 509 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 257101

Enviar uma mensagem


ZNF683 purified MaxPab mouse polyclonal antibody (B01P)

ZNF683 purified MaxPab mouse polyclonal antibody (B01P)