NUT monoclonal antibody (M03), clone 8B1
  • NUT monoclonal antibody (M03), clone 8B1

NUT monoclonal antibody (M03), clone 8B1

Ref: AB-H00256646-M03
NUT monoclonal antibody (M03), clone 8B1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NUT.
Información adicional
Size 100 ug
Gene Name C15orf55
Gene Alias DKFZp434O192|MGC138683|MGC138684|NUT
Gene Description chromosome 15 open reading frame 55
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq REHPLSPHHASGGQGSQRASHLLPAGAKGPSKLPYPVAKSGKRALAGGPAPTEKTPHSGAQLGVPREKPLALGVVRPSQPRKRRCDSFVTGRRKKRRRSQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NUT (NP_786883.1, 1033 a.a. ~ 1132 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 256646
Clone Number 8B1
Iso type IgG2a Kappa

Enviar uma mensagem


NUT monoclonal antibody (M03), clone 8B1

NUT monoclonal antibody (M03), clone 8B1