BCL6B polyclonal antibody (A01)
  • BCL6B polyclonal antibody (A01)

BCL6B polyclonal antibody (A01)

Ref: AB-H00255877-A01
BCL6B polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant BCL6B.
Información adicional
Size 50 uL
Gene Name BCL6B
Gene Alias BAZF|ZBTB28|ZNF62
Gene Description B-cell CLL/lymphoma 6, member B (zinc finger protein)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq GPIPGPQSRLSPTAATVQFKCGAPASTPYLLTSQAQDTSGSPSERARPLPGSEFFSCQNCEAVAGCSSGLDSLVPGDEDKPYKCQLCRSSFRYKGNLA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen BCL6B (NP_862827, 248 a.a. ~ 345 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 255877

Enviar uma mensagem


BCL6B polyclonal antibody (A01)

BCL6B polyclonal antibody (A01)