ZNF396 MaxPab rabbit polyclonal antibody (D01)
  • ZNF396 MaxPab rabbit polyclonal antibody (D01)

ZNF396 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00252884-D01
ZNF396 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ZNF396 protein.
Información adicional
Size 100 uL
Gene Name ZNF396
Gene Alias FLJ31213|ZSCAN14
Gene Description zinc finger protein 396
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MSAKLGKSSSLLTQTSEECNGILTEKMEEEEQTCDPDSSLHWSSSYSPETFRQQFRQFGYQDSPGPHEALSRLWELCHLWLRPEVHTKEQILELLVLEQFLAILPKELQAWVQKHHPENGEETVTMLEDVERELDGPKQIFFGRRKDMIAEKLAPSEITEELPSSQLMPVKKQLQGASWELQSLRPHDEDIKTTNVKSASRQKTSLGIELHCNVSNILHMNGSQSSTYRGTYEQDGRFEKRQGNPSWKKQQKCDE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ZNF396 (NP_665699.1, 1 a.a. ~ 333 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 252884

Enviar uma mensagem


ZNF396 MaxPab rabbit polyclonal antibody (D01)

ZNF396 MaxPab rabbit polyclonal antibody (D01)