ATP6V1C2 monoclonal antibody (M01), clone 3D5
  • ATP6V1C2 monoclonal antibody (M01), clone 3D5

ATP6V1C2 monoclonal antibody (M01), clone 3D5

Ref: AB-H00245973-M01
ATP6V1C2 monoclonal antibody (M01), clone 3D5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ATP6V1C2.
Información adicional
Size 100 ug
Gene Name ATP6V1C2
Gene Alias ATP6C2|VMA5
Gene Description ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq VPKPNYSQWQKTYESLSDMVVPRSTKLITEDKEGGLFTVTLFRKVIEDFKTKAKENKFTVREFYYD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ATP6V1C2 (NP_653184, 188 a.a. ~ 253 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 245973
Clone Number 3D5
Iso type IgG2b Kappa

Enviar uma mensagem


ATP6V1C2 monoclonal antibody (M01), clone 3D5

ATP6V1C2 monoclonal antibody (M01), clone 3D5