ATP6V1C2 MaxPab rabbit polyclonal antibody (D01)
  • ATP6V1C2 MaxPab rabbit polyclonal antibody (D01)

ATP6V1C2 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00245973-D01
ATP6V1C2 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ATP6V1C2 protein.
Información adicional
Size 100 uL
Gene Name ATP6V1C2
Gene Alias ATP6C2|VMA5
Gene Description ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MSEFWLISAPGDKENLQALERMNTVTSKSNLSYNTKFAIPDFKVGTLDSLVGLSDELGKLDTFAESLIRRMAQSVVEVMEDSKGKVQEHLLANGVDLTSFVTHFEWDMAKYPVKQPLVSVVDTIAKQLAQIEMDLKSRTAAYDTLKTNLENLEKKSMGNLFTRTLSDIVSKEDFVLDSEYLVTLLVIVPKPNYSQWQKTYESLSDMVVPRSTKLITEDKEGGLFTVTLFRKVIEDFKTKAKENKFTVREFYYDEK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ATP6V1C2 (AAH12142.1, 1 a.a. ~ 381 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 245973

Enviar uma mensagem


ATP6V1C2 MaxPab rabbit polyclonal antibody (D01)

ATP6V1C2 MaxPab rabbit polyclonal antibody (D01)