VGLL2 purified MaxPab mouse polyclonal antibody (B01P)
  • VGLL2 purified MaxPab mouse polyclonal antibody (B01P)

VGLL2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00245806-B01P
VGLL2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human VGLL2 protein.
Información adicional
Size 50 ug
Gene Name VGLL2
Gene Alias VGL2|VITO1
Gene Description vestigial like 2 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IF
Immunogen Prot. Seq MSCLDVMYQVYGPPQPYFAAAYTPYHQKLAYYSKMQEAQECNASPSSSGSGSSSFSSQTPASIKEEEGSPEKERPPEAEYINSRCVLFTYFQGDISSVVDEHFSRALSQPSSYSPSCTSSKAPRSSGPWRDCSFPMSQRSFPASFWNSAYQAPVPPPLGSPLATAHSELPFAAADPYSPAALHGHLHQGATEPWHHAHPHHAHPHHPYALGGALGAQAAPYPRPAAVHEVYAPHFDPRYGPLLMPAASGRPARLA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen VGLL2 (NP_872586.1, 1 a.a. ~ 317 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 245806

Enviar uma mensagem


VGLL2 purified MaxPab mouse polyclonal antibody (B01P)

VGLL2 purified MaxPab mouse polyclonal antibody (B01P)