ZNRF2 polyclonal antibody (A01)
  • ZNRF2 polyclonal antibody (A01)

ZNRF2 polyclonal antibody (A01)

Ref: AB-H00223082-A01
ZNRF2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ZNRF2.
Información adicional
Size 50 uL
Gene Name ZNRF2
Gene Alias RNF202
Gene Description zinc and ring finger 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LPAHLSPHMFGGFKCPVCSKFVSSDEMDLHLVMCLTKPRITYNEDVLSKDAGECAICLEELQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ZNRF2 (NP_667339, 146 a.a. ~ 207 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 223082

Enviar uma mensagem


ZNRF2 polyclonal antibody (A01)

ZNRF2 polyclonal antibody (A01)