ATXN7L1 monoclonal antibody (M06), clone 1H2 View larger

Mouse monoclonal antibody raised against a full-length recombinant ATXN7L1.

AB-H00222255-M06

New product

ATXN7L1 monoclonal antibody (M06), clone 1H2

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name ATXN7L1
Gene Alias ATXN7L4|FLJ40255|FLJ58242|KIAA1218|MGC10760|MGC33190
Gene Description ataxin 7-like 1
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MTSERSRIPCLSAAAAEGTGKKQQEGRAMATLDRKVPSPEAFLGKPWSSWIDAAKLHCSDNVDLEEAGKEGGKSREVMRLNKEDMHLFGHYPAHDDFYLVVCSACNQVVKPQVFQSHCGRKQDNRRNEGISRSGPESSQAIEKHQV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ATXN7L1 (NP_689962.1, 1 a.a. ~ 146 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 222255
Clone Number 1H2
Iso type IgG2a Kappa

More info

Mouse monoclonal antibody raised against a full-length recombinant ATXN7L1.

Enviar uma mensagem

Mouse monoclonal antibody raised against a full-length recombinant ATXN7L1.

Mouse monoclonal antibody raised against a full-length recombinant ATXN7L1.