C7orf27 purified MaxPab mouse polyclonal antibody (B01P)
  • C7orf27 purified MaxPab mouse polyclonal antibody (B01P)

C7orf27 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00221927-B01P
C7orf27 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human C7orf27 protein.
Información adicional
Size 50 ug
Gene Name C7orf27
Gene Alias MGC22916
Gene Description chromosome 7 open reading frame 27
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MDPECAQLLPALCAVLVDPGQPVADDTCLEKLLDWFKTVTEGESSVVLLQEHPCLVELLSHVLKVQDLSSGVLSFSLRLAGTFAAQENCFQYLQQGELLPGLFGEPGPLGRATWAVPTVRSGWIQGLRSLAQHPSALRFLADHGAVDTIFSLQGDSSLFVASAASQLLVHVLALSMRGGAEGQPCLPGGDWPACAQKIMDHVEESLCSAATPKVTQALNVLTTTFGRCQSPWTEALWVRLSPRVACLLERDPIPA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen C7orf27 (NP_689956, 1 a.a. ~ 821 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 221927

Enviar uma mensagem


C7orf27 purified MaxPab mouse polyclonal antibody (B01P)

C7orf27 purified MaxPab mouse polyclonal antibody (B01P)