C6orf199 monoclonal antibody (M01), clone 1H8
  • C6orf199 monoclonal antibody (M01), clone 1H8

C6orf199 monoclonal antibody (M01), clone 1H8

Ref: AB-H00221264-M01
C6orf199 monoclonal antibody (M01), clone 1H8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant C6orf199.
Información adicional
Size 100 ug
Gene Name C6orf199
Gene Alias FLJ42177|MGC26954|RP1-70A9.1|dJ70A9.1
Gene Description chromosome 6 open reading frame 199
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq YKLIAPRYRWQRSKWGRTCPVNLKDGNIYSGLPDYSVSFLGKIYCLSSEEALKPFLLNPRPYLLPPMPGPPCKVFILGPQYSGKTTLCNMLAENYKGKVTN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen C6orf199 (NP_659462, 321 a.a. ~ 421 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 221264
Clone Number 1H8
Iso type IgG2a Kappa

Enviar uma mensagem


C6orf199 monoclonal antibody (M01), clone 1H8

C6orf199 monoclonal antibody (M01), clone 1H8