UNC13D monoclonal antibody (M05), clone 2C7
  • UNC13D monoclonal antibody (M05), clone 2C7

UNC13D monoclonal antibody (M05), clone 2C7

Ref: AB-H00201294-M05
UNC13D monoclonal antibody (M05), clone 2C7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant UNC13D.
Información adicional
Size 100 ug
Gene Name UNC13D
Gene Alias FHL3|HLH3|HPLH3|Munc13-4
Gene Description unc-13 homolog D (C. elegans)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq ATLLSHPQQRPPFLRQAIKIRRRRVRDLQDPPPQMAPEIQPPSHHFSPEQRALLYEDALYTVLHRLGHPEPNHVTEASELLRYLQEAFHVEPEEHQQTL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen UNC13D (NP_954712.1, 2 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 201294
Clone Number 2C7
Iso type IgG2a Kappa

Enviar uma mensagem


UNC13D monoclonal antibody (M05), clone 2C7

UNC13D monoclonal antibody (M05), clone 2C7