U2AF1L4 purified MaxPab mouse polyclonal antibody (B01P)
  • U2AF1L4 purified MaxPab mouse polyclonal antibody (B01P)

U2AF1L4 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00199746-B01P
U2AF1L4 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human U2AF1L4 protein.
Información adicional
Size 50 ug
Gene Name U2AF1L4
Gene Alias FLJ35525|MGC33901|U2AF1-RS3|U2AF1L3|U2AF1L3V1|U2AF1RS3|U2af26
Gene Description U2 small nuclear RNA auxiliary factor 1-like 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MAEYLASIFGTEKDKVNCSFYFKIGVCRHGDRCSRLHNKPTFSQEVFTELQEKYGEIEEMNVCDNLGDHVVGNVYVKFRREEDGERAVAELSNRWFNGQAVHGNVPEVASATSCICGPFPRTSRGSSMGGDPGAGHPRGSILATIPERGTIGVPLITGMAASEALAPLPFTPNRDRCSWQDLSSKPPSLSCPILPRLPGSIM
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen U2AF1L4 (AAH21186.1, 1 a.a. ~ 202 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 199746

Enviar uma mensagem


U2AF1L4 purified MaxPab mouse polyclonal antibody (B01P)

U2AF1L4 purified MaxPab mouse polyclonal antibody (B01P)