UBR1 monoclonal antibody (M01), clone 2F5
  • UBR1 monoclonal antibody (M01), clone 2F5

UBR1 monoclonal antibody (M01), clone 2F5

Ref: AB-H00197131-M01
UBR1 monoclonal antibody (M01), clone 2F5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant UBR1.
Información adicional
Size 100 ug
Gene Name UBR1
Gene Alias JBS|MGC142065|MGC142067
Gene Description ubiquitin protein ligase E3 component n-recognin 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq ADEEAGGTERMEISAELPQTPQRLASWWDQQVDFYTAFLHHLAQLVPEIYFAEMDPDLEKQEESVQMSIFTPLEWYLFGEDPDICLEKLKHSGAFQLCG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen UBR1 (NP_777576, 2 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 197131
Clone Number 2F5
Iso type IgG1 Kappa

Enviar uma mensagem


UBR1 monoclonal antibody (M01), clone 2F5

UBR1 monoclonal antibody (M01), clone 2F5