UBR1 polyclonal antibody (A01)
  • UBR1 polyclonal antibody (A01)

UBR1 polyclonal antibody (A01)

Ref: AB-H00197131-A01
UBR1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant UBR1.
Información adicional
Size 50 uL
Gene Name UBR1
Gene Alias JBS|MGC142065|MGC142067
Gene Description ubiquitin protein ligase E3 component n-recognin 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq ADEEAGGTERMEISAELPQTPQRLASWWDQQVDFYTAFLHHLAQLVPEIYFAEMDPDLEKQEESVQMSIFTPLEWYLFGEDPDICLEKLKHSGAFQLCG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen UBR1 (NP_777576, 2 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 197131

Enviar uma mensagem


UBR1 polyclonal antibody (A01)

UBR1 polyclonal antibody (A01)