C13orf39 purified MaxPab mouse polyclonal antibody (B01P)
  • C13orf39 purified MaxPab mouse polyclonal antibody (B01P)

C13orf39 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00196541-B01P
C13orf39 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human C13orf39 protein.
Información adicional
Size 50 ug
Gene Name C13orf39
Gene Alias -
Gene Description chromosome 13 open reading frame 39
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MDVCLSSAQQPGRRGEGLSSPGGWLEAEKKGAPQKDSTGGVLEESNKIEPSLHSLQKFVPTDYASYTQEHYRFAGKEIVIQESIESYGAVVWPGAMALCQYLEEHAEELNFQDAKILEIGAGPGLVSIVASILGAQVTATDLPDVLGNLQYNLLKNTLQCTAHLPEVKELVWGEDLDKNFPKSAFYYDYVLASDVVYHHYFLDKLLTTMVYLSQPGTVLLWANKFRFSTDYEFLDKFKQVFDTTLLAEYPESSVK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen C13orf39 (NP_001010977, 1 a.a. ~ 264 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 196541

Enviar uma mensagem


C13orf39 purified MaxPab mouse polyclonal antibody (B01P)

C13orf39 purified MaxPab mouse polyclonal antibody (B01P)