C9orf96 monoclonal antibody (M05), clone 3G3
  • C9orf96 monoclonal antibody (M05), clone 3G3

C9orf96 monoclonal antibody (M05), clone 3G3

Ref: AB-H00169436-M05
C9orf96 monoclonal antibody (M05), clone 3G3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant C9orf96.
Información adicional
Size 100 ug
Gene Name C9orf96
Gene Alias MGC43306|RP11-244N20.8
Gene Description chromosome 9 open reading frame 96
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MLGPGSNRRRPTQGERGPGSPGEPMEKYQVLYQLNPGALGVNLVVEEMETKVKHVIKQVECMDDHYASQALEELMPLLKLRHAHISVYQELFITWNGEI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen C9orf96 (NP_714921, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 169436
Clone Number 3G3
Iso type IgG2a Kappa

Enviar uma mensagem


C9orf96 monoclonal antibody (M05), clone 3G3

C9orf96 monoclonal antibody (M05), clone 3G3