ZNF509 purified MaxPab mouse polyclonal antibody (B01P)
  • ZNF509 purified MaxPab mouse polyclonal antibody (B01P)

ZNF509 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00166793-B01P
ZNF509 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ZNF509 protein.
Información adicional
Size 50 ug
Gene Name ZNF509
Gene Alias FLJ38559|MGC126279|MGC126280
Gene Description zinc finger protein 509
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MQRKLVKHRIRHTGERPYSCSACGKCFGGSGDLRRHVRTHTGEKPYTCEICNKCFTRSAVLRRHKKMHCKAGDESPDVLEELSQAIETSDLEKSQSSDSFSQDTSVTLMPVSVKLPVHPVENSVVEFDSHSGGSYCKLRSMIQPHGVSDQEKLSLDPGKLAKPQMQQTQPQAYAYSDVDTPAGGEPLQADGMAMIRSSLAALDNHGGDPLGSRASSTTYRNSEGQFFSSMTLWGLAMKTLQNENELDQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ZNF509 (AAH16477.1, 1 a.a. ~ 248 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 166793

Enviar uma mensagem


ZNF509 purified MaxPab mouse polyclonal antibody (B01P)

ZNF509 purified MaxPab mouse polyclonal antibody (B01P)