TRIM60 MaxPab mouse polyclonal antibody (B01)
  • TRIM60 MaxPab mouse polyclonal antibody (B01)

TRIM60 MaxPab mouse polyclonal antibody (B01)

Ref: AB-H00166655-B01
TRIM60 MaxPab mouse polyclonal antibody (B01)

Información del producto

Mouse polyclonal antibody raised against a full-length human TRIM60 protein.
Información adicional
Size 50 uL
Gene Name TRIM60
Gene Alias FLJ35882|MGC119325|RNF129|RNF33
Gene Description tripartite motif-containing 60
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MEFVTALVNLQEESSCPICLEYLKDPVTINCGHNFCRSCLSVSWKDLDDTFPCPVCRFCFPYKSFRRNPQLRNLTEIAKQLQIRRSKRKRQKENAMCEKHNQFLTLFCVKDLEILCTQCSFSTKHQKHYICPIKKAASYHREILEGSLEPLRNNIERVEKVIILQGSKSVELKKKVEYKREEINSEFEQIRLFLQNEQEMILRQIQDEEMNILAKLNENLVELSDYVSTLKHLLREVEGKSVQSNLELLTQAKSM
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TRIM60 (NP_689833.1, 1 a.a. ~ 471 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 166655

Enviar uma mensagem


TRIM60 MaxPab mouse polyclonal antibody (B01)

TRIM60 MaxPab mouse polyclonal antibody (B01)