UBL4B monoclonal antibody (M04), clone 3B2
  • UBL4B monoclonal antibody (M04), clone 3B2

UBL4B monoclonal antibody (M04), clone 3B2

Ref: AB-H00164153-M04
UBL4B monoclonal antibody (M04), clone 3B2

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant UBL4B.
Información adicional
Size 100 ug
Gene Name UBL4B
Gene Alias FLJ25690
Gene Description ubiquitin-like 4B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MFLTVKLLLGQRCSLKVSGQESVATLKRLVSRRLKVPEEQQHLLFRGQLLEDDKHLSDYCIGPNASINVIMQPLEKMALKEAHQPQTQPLWHQLGLVLAKHFEPQDAKAVLQLLRQEHEERLQKISLEHLEQLAQYLLAEEPHVEPAGERELEAKARPQSSCDMEEKEEAAADQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen UBL4B (NP_981957.1, 1 a.a. ~ 174 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 164153
Clone Number 3B2
Iso type IgG2a Kappa

Enviar uma mensagem


UBL4B monoclonal antibody (M04), clone 3B2

UBL4B monoclonal antibody (M04), clone 3B2