ZNF100 monoclonal antibody (M01), clone 3C3
  • ZNF100 monoclonal antibody (M01), clone 3C3

ZNF100 monoclonal antibody (M01), clone 3C3

Ref: AB-H00163227-M01
ZNF100 monoclonal antibody (M01), clone 3C3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ZNF100.
Información adicional
Size 100 ug
Gene Name ZNF100
Gene Alias FLJ44587
Gene Description zinc finger protein 100
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq RHEMVAKPPVICSHFPQDLWAEQDIKDSFQEAILKKYGKYGHDNLQLQKGCKSVDECKVHKEHDNKLNQCLITTQSNIFQCDPSAKVFHTFSNSNRHKIRHTRKKPFK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ZNF100 (NP_775802.1, 99 a.a. ~ 206 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 163227
Clone Number 3C3
Iso type IgG2a Kappa

Enviar uma mensagem


ZNF100 monoclonal antibody (M01), clone 3C3

ZNF100 monoclonal antibody (M01), clone 3C3