ZNF296 purified MaxPab mouse polyclonal antibody (B01P)
  • ZNF296 purified MaxPab mouse polyclonal antibody (B01P)

ZNF296 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00162979-B01P
ZNF296 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ZNF296 protein.
Información adicional
Size 50 ug
Gene Name ZNF296
Gene Alias ZNF342
Gene Description zinc finger protein 296
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,IHC-P,IF
Immunogen Prot. Seq MSRRKAGSAPRRVEPAPAANPDDEMEMQDLVIELKPEPDAQPQQAPRLGPFSPKEVSSAGRFGGEPHHSPGPMPAGAALLALGPRNPWTLWTPLTPNYPDRQPWTDKHPDLLTCGRCLQTFPLEAITAFMDHKKLGCQLFRGPSRGQGSEREELKALSCLRCGKQFTVAWKLLRHAQWDHGLSIYQTESEAPEAPLLGLAEVAAAVSAVVGPAAEAKSPRASGSGLTRRSPTCPVCKKTLSSFSNLKVHMRSHTG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ZNF296 (NP_660331.1, 1 a.a. ~ 475 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 162979

Enviar uma mensagem


ZNF296 purified MaxPab mouse polyclonal antibody (B01P)

ZNF296 purified MaxPab mouse polyclonal antibody (B01P)