AMOTL1 purified MaxPab rabbit polyclonal antibody (D01P)
  • AMOTL1 purified MaxPab rabbit polyclonal antibody (D01P)

AMOTL1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00154810-D01P
AMOTL1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human AMOTL1 protein.
Información adicional
Size 100 ug
Gene Name AMOTL1
Gene Alias JEAP
Gene Description angiomotin like 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MWRAKLRRGTCEPAVKGSPSACYSPSSPVQVLEDSTYFSPDFQLYSGRHETSALTVEATSSIREKVVEDPLCNFHSPNFLRISEVEMRGSEDAAAGTVLQRLIQEQLRYGTPTENMNLLAIQHQATGSAGPAHPTNNFSSTENLTQEDPQMVYQSARQEPQGQEHQVDNTVMEKQVRSTQPQQNNEELPTYEEAKAQSQFFRGQQQQQQQQGAVGHGYYMAGGTSQKSRTEGRPTVNRANSGQAHKDEALKELKQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen AMOTL1 (NP_570899.1, 1 a.a. ~ 956 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 154810

Enviar uma mensagem


AMOTL1 purified MaxPab rabbit polyclonal antibody (D01P)

AMOTL1 purified MaxPab rabbit polyclonal antibody (D01P)