AMOT polyclonal antibody (A01)
  • AMOT polyclonal antibody (A01)

AMOT polyclonal antibody (A01)

Ref: AB-H00154796-A01
AMOT polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant AMOT.
Información adicional
Size 50 uL
Gene Name AMOT
Gene Alias KIAA1071
Gene Description angiomotin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq RKEPSKTEQLSCMRPAKSLMSISNAGSGLLSHSSTLTGSPIMEEKRDDKSWKGSLGILLGGDYRAEYVPSTPSPVPPSTPLLSAHSKTGSRDCSTQTERG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen AMOT (NP_573572, 361 a.a. ~ 460 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 154796

Enviar uma mensagem


AMOT polyclonal antibody (A01)

AMOT polyclonal antibody (A01)