BTLA monoclonal antibody (M07), clone 4B8
  • BTLA monoclonal antibody (M07), clone 4B8

BTLA monoclonal antibody (M07), clone 4B8

Ref: AB-H00151888-M07
BTLA monoclonal antibody (M07), clone 4B8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant BTLA.
Información adicional
Size 100 ug
Gene Name BTLA
Gene Alias BTLA1|CD272|FLJ16065|MGC129743
Gene Description B and T lymphocyte associated
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA,IF
Immunogen Prot. Seq DTAGREINLVDAHLKSEQTEASTRQNSQVLLSETGIYDNDPDLCFRMQEGSEVYSNPCLEENKPGIVYASLNHSVIGPNSRLARNVKEAPTEYASICVRS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen BTLA (NP_861445, 190 a.a. ~ 289 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 151888
Clone Number 4B8
Iso type IgG2a Kappa

Enviar uma mensagem


BTLA monoclonal antibody (M07), clone 4B8

BTLA monoclonal antibody (M07), clone 4B8