ZSWIM2 monoclonal antibody (M01), clone 2G4
  • ZSWIM2 monoclonal antibody (M01), clone 2G4

ZSWIM2 monoclonal antibody (M01), clone 2G4

Ref: AB-H00151112-M01
ZSWIM2 monoclonal antibody (M01), clone 2G4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ZSWIM2.
Información adicional
Size 100 ug
Gene Name ZSWIM2
Gene Alias MGC33890|ZZZ2
Gene Description zinc finger, SWIM-type containing 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq MLRRGYKASERRRHLSERLSWHQDQALSSSIYLLREMGPTGFLLREEEPEYMDFRVFLGNPHVCNCSTFPKGGELCKHICWVLLKKFKLPRNHESALQL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ZSWIM2 (NP_872327.2, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 151112
Clone Number 2G4
Iso type IgG2a Kappa

Enviar uma mensagem


ZSWIM2 monoclonal antibody (M01), clone 2G4

ZSWIM2 monoclonal antibody (M01), clone 2G4